McDonnell Genome Institute

Washington University

Transcript

lnc-TXNRD3-2:1

Chromosome

chr3

Gene Name

lnc-TXNRD3-2

Start

126766433

CPC Label

noncoding

End

126767475

Cancer

EOGC

Strand

-

Peptide

ESTIAGAHHRPSGNWAK

Modified Peptide

n[145]ESTIAGAHHRPSGNWAK

Peptide Length

17

ORF Length

75

Open Reading Frame (ORF)

LWLDNPEPGLWEEQHHCGHRESTIAGAHHRPSGNWAKGPQAQVFHCSPGGEDSGWHFLRGHHGLLTLFGDTKRQK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.348804

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9989

PhyloCSF Frame 3

0

CNTI Score

0.706348217