McDonnell Genome Institute

Washington University

Transcript

lnc-TXNL4B-1:1

Chromosome

chr16

Gene Name

lnc-TXNL4B-1

Start

72027737

CPC Label

noncoding

End

72043118

Cancer

OV

Strand

-

Peptide

AIMQAIPSGK

Modified Peptide

n[145]AIMQAIPSGK

Peptide Length

10

ORF Length

55

Open Reading Frame (ORF)

MLAGGSSERLRDAGKLSISVNDWKNKGVKEHEGRAIMQAIPSGKVEKEEQLIPDQ

Conservation Score

0.419

PhyloCSF Frame 1

-4.819

No. of Spectra

2

CPC Coding Probability

0.0253216

PhyloCSF Frame 2 

-4.01

CNTI Index

noncoding

Max Probability

0.5806

PhyloCSF Frame 3

-4.558

CNTI Score

-0.393461149