McDonnell Genome Institute

Washington University

Transcript

lnc-TXNDC17-1:2

Chromosome

chr17

Gene Name

lnc-TXNDC17-1

Start

6657219

CPC Label

noncoding

End

6658160

Cancer

CRC

Strand

+

Peptide

GQVPLLPLGGGRR

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

49

Open Reading Frame (ORF)

LGPLMFVKLRKRHFLQVLQLDLRVGPRSRGRGQVPLLPLGGGRRRPEPA

Conservation Score

1

PhyloCSF Frame 1

1.535

No. of Spectra

1

CPC Coding Probability

0.066948

PhyloCSF Frame 2 

7.502

CNTI Index

noncoding

Max Probability

0.9279

PhyloCSF Frame 3

-4.228

CNTI Score

-0.296670975