McDonnell Genome Institute

Washington University

Transcript

lnc-TXNDC16-4:1

Chromosome

chr14

Gene Name

lnc-TXNDC16-4

Start

52322422

CPC Label

noncoding

End

52327702

Cancer

OV

Strand

-

Peptide

MSVIFGNSVSEVGR

Modified Peptide

n[145]MSVIFGNSVSEVGR

Peptide Length

14

ORF Length

34

Open Reading Frame (ORF)

MSVIFGNSVSEVGRSYPSFCVHYQCICYEKNTKC

Conservation Score

0.473

PhyloCSF Frame 1

-3.628

No. of Spectra

3

CPC Coding Probability

0.0625417

PhyloCSF Frame 2 

-5.339

CNTI Index

noncoding

Max Probability

0.599

PhyloCSF Frame 3

-3.546

CNTI Score

-0.369438404