McDonnell Genome Institute

Washington University

Transcript

lnc-TXNDC12-2:1

Chromosome

chr1

Gene Name

lnc-TXNDC12-2

Start

52160260

CPC Label

noncoding

End

52160600

Cancer

CCRC

Strand

-

Peptide

VDEFVTHNLSFEEINK

Modified Peptide

n[230]VDEFVTHNLSFEEINK

Peptide Length

16

ORF Length

44

Open Reading Frame (ORF)

LVSEYMSKKIKVDEFVTHNLSFEEINKAFELMHSGKSIRTVVKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

42

CPC Coding Probability

0.0274409

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.336756128