McDonnell Genome Institute

Washington University

Transcript

lnc-TXLNB-3:16

Chromosome

chr6

Gene Name

lnc-TXLNB-3

Start

139197711

CPC Label

noncoding

End

139239302

Cancer

CCRC

Strand

-

Peptide

QGAILEK

Modified Peptide

n[230]QGAILEK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MQGAILEKENGFSRHRTCWSLNLRLLSLQKYESINFCSL

Conservation Score

0.924

PhyloCSF Frame 1

-4.874

No. of Spectra

5

CPC Coding Probability

0.0258416

PhyloCSF Frame 2 

-3.633

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-4.878

CNTI Score

-0.348304079