McDonnell Genome Institute

Washington University

Transcript

lnc-TVP23A-5:1

Chromosome

chr16

Gene Name

lnc-TVP23A-5

Start

10846356

CPC Label

noncoding

End

10846908

Cancer

OV

Strand

-

Peptide

LECSGMIIAHHSLELLGSIDPAAS

Modified Peptide

n[145]LECSGM[147]IIAHHSLELLGSIDPAAS

Peptide Length

24

ORF Length

47

Open Reading Frame (ORF)

LACKMKYFYLFIYSEQGLTLSTRLECSGMIIAHHSLELLGSIDPAAS

Conservation Score

0.039

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.028043

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9434

PhyloCSF Frame 3

0

CNTI Score

-0.409964825