McDonnell Genome Institute

Washington University

Transcript

lnc-TUSC3-5:1

Chromosome

chr8

Gene Name

lnc-TUSC3-5

Start

16374617

CPC Label

noncoding

End

16375082

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

KAWLLKK

Modified Peptide

n[145]KAWLLKK

Peptide Length

7

ORF Length

92

Open Reading Frame (ORF)

MNIISVLVTGSLSKTPIQPALLSAALSDIQHPCLQPVGSAEDHIWAPQKNVEDFLSPLLAKTCITQAKELTGTLQVKGYFDQQRKAWLLKKG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.0827108

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.334584969