McDonnell Genome Institute

Washington University

Transcript

lnc-TUNAR-1:2

Chromosome

chr14

Gene Name

lnc-TUNAR-1

Start

95876257

CPC Label

noncoding

End

95898568

Cancer

CCRC

Strand

+

Peptide

GAAGARPPR

Modified Peptide

n[230]GAAGARPPR

Peptide Length

9

ORF Length

113

Open Reading Frame (ORF)

LGQEAVGGARRAGQLRPPWPPDRPCAKVSGARRPAGRAARGADAPWVGQRGAAGARPPRGAALRVLMLSLSLSLRAASPRSSRRAPARGMRSPRVPPRDQQAARTPSQRQTGT

Conservation Score

1

PhyloCSF Frame 1

-0.164

No. of Spectra

1

CPC Coding Probability

0.486537

PhyloCSF Frame 2 

-1.466

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0.068

CNTI Score

-0.251789377