McDonnell Genome Institute

Washington University

Transcript

lnc-TUFM-3:5

Chromosome

chr16

Gene Name

lnc-TUFM-3

Start

28813598

CPC Label

noncoding

End

28822934

Cancer

EOGC

Strand

-

Peptide

YSFLWLLR

Modified Peptide

n[145]YSFLWLLR

Peptide Length

8

ORF Length

70

Open Reading Frame (ORF)

MYSFLWLLRQGLALVTQAGVQQWGLGSMQPPPPRLKRSSHLSLPSSCGWNYRCAPPRPANFLFLGFFFFW

Conservation Score

0.567

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.213878

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.319653343