McDonnell Genome Institute

Washington University

Transcript

lnc-TUBGCP3-11:1

Chromosome

chr13

Gene Name

lnc-TUBGCP3-11

Start

112447518

CPC Label

coding

End

112462118

Cancer

EOGC

Strand

-

Peptide

STALCLLLNNK

Modified Peptide

n[145]STALCLLLNNK

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

MGSGRSTALCLLLNNKLSQMQWLKAHIMAQFMGSGIQGL

Conservation Score

0.063

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.892834

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8322

PhyloCSF Frame 3

0

CNTI Score

-0.251322705