McDonnell Genome Institute

Washington University

Transcript

lnc-TUBB2B-6:3

Chromosome

chr6

Gene Name

lnc-TUBB2B-6

Start

3355806

CPC Label

noncoding

End

3360410

Cancer

OV

Strand

-

Peptide

INTTVSGAEDLPR

Modified Peptide

n[145]INTTVSGAEDLPR

Peptide Length

13

ORF Length

49

Open Reading Frame (ORF)

LLVSWAGFKTWRFKPAHLTAEPIRRKTKINTTVSGAEDLPRTMKQPAGG

Conservation Score

0.434

PhyloCSF Frame 1

-4.23

No. of Spectra

1

CPC Coding Probability

0.0246451

PhyloCSF Frame 2 

-4.506

CNTI Index

noncoding

Max Probability

0.9649

PhyloCSF Frame 3

-2.5

CNTI Score

-0.40214263