McDonnell Genome Institute

Washington University

Transcript

lnc-TUBB2B-3:1

Chromosome

chr6

Gene Name

lnc-TUBB2B-3

Start

3308672

CPC Label

noncoding

End

3313276

Cancer

OSCC

Strand

-

Peptide

TIGTSASTQMPAR

Modified Peptide

n[145]TIGTSASTQMPAR

Peptide Length

13

ORF Length

43

Open Reading Frame (ORF)

LLMAWKFREPSDNTPQRLCKTIGTSASTQMPARRSGETPARGK

Conservation Score

0.989

PhyloCSF Frame 1

-5.312

No. of Spectra

11

CPC Coding Probability

0.0914311

PhyloCSF Frame 2 

-3.516

CNTI Index

noncoding

Max Probability

0.8872

PhyloCSF Frame 3

-5.024

CNTI Score

-0.374697053