McDonnell Genome Institute

Washington University

Transcript

lnc-TUBB2A-5:1

Chromosome

chr6

Gene Name

lnc-TUBB2A-5

Start

3115516

CPC Label

noncoding

End

3116473

Cancer

OSCC

Strand

-

Peptide

TLYLHNDGER

Modified Peptide

n[145]TLYLHNDGER

Peptide Length

10

ORF Length

38

Open Reading Frame (ORF)

LKSNFELLNFRTLYLHNDGERLGSKAWVTQLRRGRGEF

Conservation Score

0.035

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.242149

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9937

PhyloCSF Frame 3

0

CNTI Score

-0.363313