McDonnell Genome Institute

Washington University

Transcript

lnc-TUBAL3-1:1

Chromosome

chr10

Gene Name

lnc-TUBAL3-1

Start

5304430

CPC Label

noncoding

End

5304865

Cancer

BRCA-Basal-like

Strand

-

Peptide

HFNAPSHIHRTVMSSPLSK

Modified Peptide

n[145]HFNAPSHIHRTVM[147]SSPLSK

Peptide Length

19

ORF Length

44

Open Reading Frame (ORF)

MKFNPFVTSDRSSNCKRHFNAPSHIHRTVMSSPLSKELRQKYNV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.076209

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.915

PhyloCSF Frame 3

0

CNTI Score

-0.322743324