McDonnell Genome Institute

Washington University

Transcript

lnc-TUBA3D-1:2

Chromosome

chr2

Gene Name

lnc-TUBA3D-1

Start

131493075

CPC Label

coding

End

131516358

Cancer

EOGC

Strand

+

Peptide

AAVPRFIQQK

Modified Peptide

n[145]AAVPRFIQQK

Peptide Length

10

ORF Length

103

Open Reading Frame (ORF)

MQTPPPTRSGGQTLLQVFVEMWLHHYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHATSPLEEFKRAAVPRFIQQKLYLF

Conservation Score

1

PhyloCSF Frame 1

-4.521

No. of Spectra

1

CPC Coding Probability

0.949307

PhyloCSF Frame 2 

10.859

CNTI Index

coding

Max Probability

0.9798

PhyloCSF Frame 3

11.606

CNTI Score

0.70032582