McDonnell Genome Institute

Washington University

Transcript

lnc-TUBA3C-9:2

Chromosome

chr13

Gene Name

lnc-TUBA3C-9

Start

19046152

CPC Label

coding

End

19118283

Cancer

EOGC

Strand

-

Peptide

LLDGQCTENGSLVASR

Modified Peptide

n[145]LLDGQCTENGSLVASR

Peptide Length

16

ORF Length

56

Open Reading Frame (ORF)

LLDGQCTENGSLVASRAYEVEKRLKLGSLTQFPNFKTACWYMGKHLLEAFKVTVCS

Conservation Score

1

PhyloCSF Frame 1

7.863

No. of Spectra

5

CPC Coding Probability

0.571733

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8107

PhyloCSF Frame 3

0

CNTI Score

0.697941307