McDonnell Genome Institute

Washington University

Transcript

lnc-TUBA3C-16:1

Chromosome

chr13

Gene Name

lnc-TUBA3C-16

Start

18834402

CPC Label

noncoding

End

18871969

Cancer

BRCA-Basal-like

Strand

-

Peptide

LIDIHAALGSR

Modified Peptide

n[145]LIDIHAALGSR

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LAYSWTVSLPGFQIPSLAPQHRLIDIHAALGSRYRSESD

Conservation Score

0.033

PhyloCSF Frame 1

-5.258

No. of Spectra

4

CPC Coding Probability

0.448746

PhyloCSF Frame 2 

-5.213

CNTI Index

coding

Max Probability

0.9984

PhyloCSF Frame 3

-5.385

CNTI Score

0.669373569