McDonnell Genome Institute

Washington University

Transcript

lnc-TUBA3C-15:1

Chromosome

chr13

Gene Name

lnc-TUBA3C-15

Start

18892259

CPC Label

coding

End

18895230

Cancer

EOGC

Strand

-

Peptide

ILYCLQEGNVESKTLSMSGMESFIEKQTK

Modified Peptide

n[145]ILYCLQEGNVESKTLSM[147]SGMESFIEKQTK

Peptide Length

29

ORF Length

184

Open Reading Frame (ORF)

LKQLYAIPAIANNSEEVQEFLAVNTDARISFVKKPFMVSRIEKMVLSAIVDTLKTAFPCSESQSPTEKLSEAETESKSHIEGKKASKSRLRFLPSKISPALSVTEAQDKILYCLQEGNVESKTLSMSGMESFIEKQTKLLEMEATEAPEKDPEQLPKGHVDSCLSDAAVPAHDPATTVQEQRQS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.836078

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1006

PhyloCSF Frame 3

0

CNTI Score

0.721657424