McDonnell Genome Institute

Washington University

Transcript

lnc-TUBA1C-1:14

Chromosome

chr12

Gene Name

lnc-TUBA1C-1

Start

49131605

CPC Label

noncoding

End

49168865

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LASHDGAQLLGR

Modified Peptide

n[145]LASHDGAQLLGR

Peptide Length

12

ORF Length

67

Open Reading Frame (ORF)

LSSQHLRRPRQEDRLNPRVRDQPGHQNENLSLQKKIFKLASHDGAQLLGRLRQKGHFNTGGQVCSKL

Conservation Score

0.342

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.12951

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

0

CNTI Score

-0.327226222