McDonnell Genome Institute

Washington University

Transcript

lnc-TTPA-1:6

Chromosome

chr8

Gene Name

lnc-TTPA-1

Start

63384838

CPC Label

noncoding

End

63417930

Cancer

OV

Strand

-

Peptide

GPLHQPRSR

Modified Peptide

n[145]GPLHQPRSR

Peptide Length

9

ORF Length

71

Open Reading Frame (ORF)

LILGNVQWLPQDVGTTSCALASCHKNICPRKGPLHQPRSRNERTHGLNLKMAHSRPAVNSQPLCNAGKKEM

Conservation Score

0.236

PhyloCSF Frame 1

-5.255

No. of Spectra

1

CPC Coding Probability

0.0138712

PhyloCSF Frame 2 

-5.171

CNTI Index

noncoding

Max Probability

0.2577

PhyloCSF Frame 3

-4.457

CNTI Score

-0.424456515