McDonnell Genome Institute

Washington University

Transcript

lnc-TTLL7-7:1

Chromosome

chr1

Gene Name

lnc-TTLL7-7

Start

81585940

CPC Label

noncoding

End

81625713

Cancer

EOGC

Strand

-

Peptide

ESLHEEGGR

Modified Peptide

n[145]ESLHEEGGR

Peptide Length

9

ORF Length

74

Open Reading Frame (ORF)

LTSKESLHEEGGRTIEELARLSPSVWKWVKITDMFYFFLCFGLYDVNYLKQNPLPWLIYRFGLYQNCLKLETRH

Conservation Score

1

PhyloCSF Frame 1

-4.862

No. of Spectra

2

CPC Coding Probability

0.012738

PhyloCSF Frame 2 

-5.431

CNTI Index

noncoding

Max Probability

0.8929

PhyloCSF Frame 3

-4.13

CNTI Score

-0.401674852