McDonnell Genome Institute

Washington University

Transcript

lnc-TTLL7-5:4

Chromosome

chr1

Gene Name

lnc-TTLL7-5

Start

82533897

CPC Label

noncoding

End

82848205

Cancer

LUAD

Strand

-

Peptide

LFCLEQVK

Modified Peptide

n[230]LFCLEQVK

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LKKEGERAMEVTGWRWCPEPGINIYPSVHQRVNEAWESKTCQRLFCLEQVKIQQRI

Conservation Score

0.028

PhyloCSF Frame 1

-5.367

No. of Spectra

2

CPC Coding Probability

0.136303

PhyloCSF Frame 2 

-5.805

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-4.987

CNTI Score

-0.36372656