McDonnell Genome Institute

Washington University

Transcript

lnc-TTLL11-1:1

Chromosome

chr9

Gene Name

lnc-TTLL11-1

Start

121815673

CPC Label

noncoding

End

121819452

Cancer

OV

Strand

-

Peptide

SLDFYITGK

Modified Peptide

n[145]SLDFYITGK

Peptide Length

9

ORF Length

101

Open Reading Frame (ORF)

LQNRPRLHLPLSLVAKSLDFYITGKTTQHNAYTHTRACMHTHARTHDAHACTHAHMHTHACARTHHTCTHVHNAHMHTRTHMHTRTRMHTRAHAHTHTEHR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0789596

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9693

PhyloCSF Frame 3

0

CNTI Score

-0.305543269