McDonnell Genome Institute

Washington University

Transcript

lnc-TTC5-2:1

Chromosome

chr14

Gene Name

lnc-TTC5-2

Start

20260479

CPC Label

noncoding

End

20264308

Cancer

OV

Strand

-

Peptide

ISLCINQSHILNFPRTWLVFSAHSQLLAGLHR

Modified Peptide

n[145]ISLCINQSHILNFPRTWLVFSAHSQLLAGLHR

Peptide Length

32

ORF Length

103

Open Reading Frame (ORF)

LLSTGEAQCLLLASLLPSFFLILIFYAEVLVYLFSEDIWTKMLFLISNENYVVRISLCINQSHILNFPRTWLVFSAHSQLLAGLHRAGNNGKVLTENFASISG

Conservation Score

0.426

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0417483

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5823

PhyloCSF Frame 3

-4.996

CNTI Score

-0.398288555