McDonnell Genome Institute

Washington University

Transcript

lnc-TTC30B-1:1

Chromosome

chr2

Gene Name

lnc-TTC30B-1

Start

177283511

CPC Label

coding

End

177392691

Cancer

CCRC

Strand

-

Peptide

SPETSILK

Modified Peptide

n[230]SPETSILK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LGSSAFSRSPETSILKAEGLGWSFMLNRLTKYTYSTGYRRSYEYS

Conservation Score

0.347

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.772681

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9945

PhyloCSF Frame 3

0

CNTI Score

-0.355614457