McDonnell Genome Institute

Washington University

Transcript

lnc-TTC3-5:4

Chromosome

chr21

Gene Name

lnc-TTC3-5

Start

37267735

CPC Label

noncoding

End

37272798

Cancer

PRAD

Strand

+

Peptide

LIMSASWELR

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

103

Open Reading Frame (ORF)

LMCSKLLQSVVALNNKRLIMSASWELRSSFPGCSWLKVSDSCSCLKACCRLEDPVPRWLPHMAEVGSTHFHSTGCLRSLTVWQLASPRPVNQERVQLGSCNAL

Conservation Score

0.937

PhyloCSF Frame 1

-4.59

No. of Spectra

1

CPC Coding Probability

0.0936768

PhyloCSF Frame 2 

-4.783

CNTI Index

noncoding

Max Probability

0.9933

PhyloCSF Frame 3

-3.599

CNTI Score

-0.362378827