McDonnell Genome Institute

Washington University

Transcript

lnc-TTC23-3:3

Chromosome

chr15

Gene Name

lnc-TTC23-3

Start

99422605

CPC Label

coding

End

99435211

Cancer

HCC

Strand

-

Peptide

LNLPLPELK

Modified Peptide

n[43]LNLPLPELK

Peptide Length

9

ORF Length

87

Open Reading Frame (ORF)

LNLPLPELKAVRFVVRSAPGPLRVRPRWVCQACTWAADAQEAEPSLPRLCVHLSAPCLTLRSRERDFSLAASHPEENISSQQNIRQV

Conservation Score

1

PhyloCSF Frame 1

-2.654

No. of Spectra

31

CPC Coding Probability

0.711345

PhyloCSF Frame 2 

-2.953

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-0.763

CNTI Score

-0.273867566