McDonnell Genome Institute

Washington University

Transcript

lnc-TTC23-2:4

Chromosome

chr15

Gene Name

lnc-TTC23-2

Start

99391621

CPC Label

noncoding

End

99403713

Cancer

LUAD

Strand

-

Peptide

KDMGLGK

Modified Peptide

KDM[147]GLGK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

MRSRKDMGLGKTVPKESGVRRQLLEVATGTGKNQVISCFLLIFVTSDDSAL

Conservation Score

1

PhyloCSF Frame 1

-1.055

No. of Spectra

7

CPC Coding Probability

0.298305

PhyloCSF Frame 2 

-1.592

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

1.116

CNTI Score

-0.317496741