McDonnell Genome Institute

Washington University

Transcript

lnc-TSTD2-4:1

Chromosome

chr9

Gene Name

lnc-TSTD2-4

Start

97390838

CPC Label

noncoding

End

97396691

Cancer

OSCC

Strand

-

Peptide

TTCIQMGR

Modified Peptide

n[145]TTCIQM[147]GR

Peptide Length

8

ORF Length

68

Open Reading Frame (ORF)

LPLGKTTCIQMGRQTRWLIKKETDAIWGGTGISHFLVLGVSEEGLSENATLLCLPILGPGSSCAGCPQ

Conservation Score

0.69

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0487369

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8618

PhyloCSF Frame 3

0

CNTI Score

-0.355244803