McDonnell Genome Institute

Washington University

Transcript

lnc-TSTD2-1:1

Chromosome

chr9

Gene Name

lnc-TSTD2-1

Start

97634514

CPC Label

noncoding

End

97636051

Cancer

CCRC

Strand

-

Peptide

TQVLQPPK

Modified Peptide

TQVLQPPK

Peptide Length

8

ORF Length

74

Open Reading Frame (ORF)

LVLKTSQLQESYGLPLSEKKEALEQQRKEQKTQVLQPPKLFHLYEGNTDLHEHNHPNGDGNPCSNSLRGLKLVF

Conservation Score

0.984

PhyloCSF Frame 1

-3.961

No. of Spectra

1

CPC Coding Probability

0.00929731

PhyloCSF Frame 2 

-3.23

CNTI Index

noncoding

Max Probability

0.0567

PhyloCSF Frame 3

-4.258

CNTI Score

-0.454435308