McDonnell Genome Institute

Washington University

Transcript

lnc-TSTA3-5:1

Chromosome

chr8

Gene Name

lnc-TSTA3-5

Start

143632418

CPC Label

noncoding

End

143634878

Cancer

OSCC

Strand

-

Peptide

KSFPANK

Modified Peptide

n[145]KSFPANK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MKSFPANKFTYFLKINCRVLNCPFDEEDSPGTKARYQGE

Conservation Score

0.683

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0160567

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

0

CNTI Score

-0.315393869