McDonnell Genome Institute

Washington University

Transcript

lnc-TSSK6-4:2

Chromosome

chr19

Gene Name

lnc-TSSK6-4

Start

19354734

CPC Label

noncoding

End

19358079

Cancer

CRC

Strand

-

Peptide

QALIGAGRPMPILR

Modified Peptide

Peptide Length

14

ORF Length

102

Open Reading Frame (ORF)

LVDLWVPGTSLDLSPVLGSQSPCASRPHRAEQGWLGSESPMPGFSPALQGAHGQPSGKQALIGAGRPMPILRQQPQAAHCTWSTPSPVTSPGPQASLRTLVS

Conservation Score

0.397

PhyloCSF Frame 1

-3.674

No. of Spectra

1

CPC Coding Probability

0.25551

PhyloCSF Frame 2 

-2.967

CNTI Index

noncoding

Max Probability

0.6128

PhyloCSF Frame 3

-2.489

CNTI Score

-0.340513445