McDonnell Genome Institute

Washington University

Transcript

lnc-TSSK6-3:1

Chromosome

chr19

Gene Name

lnc-TSSK6-3

Start

19533698

CPC Label

coding

End

19536333

Cancer

BRCA-Luminal A

Strand

-

Peptide

LCQVGAGK

Modified Peptide

n[145]LCQVGAGK

Peptide Length

8

ORF Length

35

Open Reading Frame (ORF)

LEMQRPGLRLCQVGAGKTCIQPLPVARSAVCLFSA

Conservation Score

1

PhyloCSF Frame 1

-3.253

No. of Spectra

45

CPC Coding Probability

0.939869

PhyloCSF Frame 2 

-2.145

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-0.463

CNTI Score

-0.303854409