McDonnell Genome Institute

Washington University

Transcript

lnc-TSSK4-3:2

Chromosome

chr14

Gene Name

lnc-TSSK4-3

Start

24195726

CPC Label

noncoding

End

24203700

Cancer

BRCA-Luminal B

Strand

+

Peptide

WEFIACLWHNLFLK

Modified Peptide

n[145]WEFIACLWHNLFLK

Peptide Length

14

ORF Length

72

Open Reading Frame (ORF)

LASNRTLEPSCQQGQTVNKWEFIACLWHNLFLKYSVLEDGRYENLDSSLVLFSAPLSPTDIVWIVIPAQISC

Conservation Score

0.967

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.107547

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.290602397