McDonnell Genome Institute

Washington University

Transcript

lnc-TSSK2-4:1

Chromosome

chr22

Gene Name

lnc-TSSK2-4

Start

19055800

CPC Label

noncoding

End

19056512

Cancer

CCRC

Strand

+

Peptide

TVGVDPAADGK

Modified Peptide

n[230]TVGVDPAADGK

Peptide Length

11

ORF Length

94

Open Reading Frame (ORF)

LIHCRTVGVDPAADGKGVVVVMEWRSGQQKPATSYRTTVNKNACTMLGNITHMIRKNKASPQPAHSCHPRASAILRSQKPVMVKRKGTCPTKSS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0717439

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8723

PhyloCSF Frame 3

0

CNTI Score

-0.291679169