McDonnell Genome Institute

Washington University

Transcript

lnc-TSSC4-2:2

Chromosome

chr11

Gene Name

lnc-TSSC4-2

Start

2376199

CPC Label

noncoding

End

2377189

Cancer

OV

Strand

+

Peptide

SATAAWGR

Modified Peptide

n[145]SATAAWGR

Peptide Length

8

ORF Length

116

Open Reading Frame (ORF)

LQKVLSASTGLDDTCQDELARGWFSGPGPTWFPGSSPGEQCEQSLLSLQSQPLWHQLLQEALPDCPRRGPAATPLGARSATAAWGRLPRPARCTWALRSWPKRAKLGVGAATPYPS

Conservation Score

0.19

PhyloCSF Frame 1

-3.763

No. of Spectra

1

CPC Coding Probability

0.00907934

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8868

PhyloCSF Frame 3

0

CNTI Score

-0.358168368