McDonnell Genome Institute

Washington University

Transcript

lnc-TSR3-1:4

Chromosome

chr16

Gene Name

lnc-TSR3-1

Start

1319254

CPC Label

noncoding

End

1322827

Cancer

OV

Strand

-

Peptide

PIIPALWEARR

Modified Peptide

n[145]PIIPALWEARR

Peptide Length

11

ORF Length

47

Open Reading Frame (ORF)

MPIIPALWEARRVDHLRSEVRDQPGQRGETLSLLKIQKLVRCGGGCL

Conservation Score

0.027

PhyloCSF Frame 1

0

No. of Spectra

42

CPC Coding Probability

0.189

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9343

PhyloCSF Frame 3

0

CNTI Score

-0.256206851