McDonnell Genome Institute

Washington University

Transcript

lnc-TSR3-1:2

Chromosome

chr16

Gene Name

lnc-TSR3-1

Start

1320181

CPC Label

noncoding

End

1324783

Cancer

OSCC

Strand

-

Peptide

RAGLAMWPRLVSNSWAQVTSHSGLAK

Modified Peptide

n[145]RAGLAMWPRLVSNSWAQVTSHSGLAK

Peptide Length

26

ORF Length

75

Open Reading Frame (ORF)

LGLQACTIIPGLIFFFFFFLKRAGLAMWPRLVSNSWAQVTSHSGLAKCWDYRHEPPPLANFLIFCRDRVSLCCPV

Conservation Score

0.031

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.246426

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3049

PhyloCSF Frame 3

0

CNTI Score

-0.249995563