McDonnell Genome Institute

Washington University

Transcript

lnc-TSPYL6-1:1

Chromosome

chr2

Gene Name

lnc-TSPYL6-1

Start

54119083

CPC Label

noncoding

End

54126616

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

SLLGQVGR

Modified Peptide

n[145]SLLGQVGR

Peptide Length

8

ORF Length

70

Open Reading Frame (ORF)

LVTAPLDQLRADHRAKASAGSRPVAQPERSLLGQVGRVSPVGPSKAWAEVPLAVEISGWQSGTERILCHQ

Conservation Score

0.046

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0772586

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9951

PhyloCSF Frame 3

0

CNTI Score

-0.319238523