McDonnell Genome Institute

Washington University

Transcript

lnc-TSPY10-10:1

Chromosome

chrY

Gene Name

lnc-TSPY10-10

Start

10088025

CPC Label

coding

End

10089586

Cancer

OV

Strand

+

Peptide

ALLCPALALEPRQL

Modified Peptide

n[145]ALLCPALALEPRQL

Peptide Length

14

ORF Length

87

Open Reading Frame (ORF)

LGSPLALCLAVEKLFWIPHCPSCKAPSCLTHPEPPGLPESNSWPSPAGPFSHNAHSIVACPKEDLAHGQQSRKALLCPALALEPRQL

Conservation Score

0.905

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.534938

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0603

PhyloCSF Frame 3

0

CNTI Score

-0.349635454