McDonnell Genome Institute

Washington University

Transcript

lnc-TSPOAP1-1:1

Chromosome

chr17

Gene Name

lnc-TSPOAP1-1

Start

58329667

CPC Label

coding

End

58332520

Cancer

CCRC

Strand

-

Peptide

SEEGSGPGQATAGGEK

Modified Peptide

n[230]SEEGSGPGQATAGGEK

Peptide Length

16

ORF Length

79

Open Reading Frame (ORF)

LDCASLLSETLLLGWGAECGRQAHGQYGRTEGLGGRTSVAPPEDTGLALPMRSEEGSGPGQATAGGEKGLGHLQKGAGM

Conservation Score

1

PhyloCSF Frame 1

-4.761

No. of Spectra

1

CPC Coding Probability

0.531384

PhyloCSF Frame 2 

-4.595

CNTI Index

noncoding

Max Probability

0.2089

PhyloCSF Frame 3

-3.026

CNTI Score

-0.329170749