McDonnell Genome Institute

Washington University

Transcript

lnc-TSPAN14-2:3

Chromosome

chr10

Gene Name

lnc-TSPAN14-2

Start

80529568

CPC Label

noncoding

End

80533481

Cancer

CCRC

Strand

+

Peptide

LSPAVADPYMVAVPGSAALR

Modified Peptide

n[230]LSPAVADPYM[147]VAVPGSAALR

Peptide Length

20

ORF Length

40

Open Reading Frame (ORF)

MLLILTPIIFQWRQGRNYSRLSPAVADPYMVAVPGSAALR

Conservation Score

0.933

PhyloCSF Frame 1

-5.32

No. of Spectra

6

CPC Coding Probability

0.0900866

PhyloCSF Frame 2 

-4.754

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-4.541

CNTI Score

-0.352807442