McDonnell Genome Institute

Washington University

Transcript

lnc-TSPAN14-1:4

Chromosome

chr10

Gene Name

lnc-TSPAN14-1

Start

80435008

CPC Label

noncoding

End

80437113

Cancer

OV

Strand

+

Peptide

LFVLKINDLQLSR

Modified Peptide

n[145]LFVLKINDLQLSR

Peptide Length

13

ORF Length

40

Open Reading Frame (ORF)

LFVLKINDLQLSRFQWAVWVGLSFCFFFFFMYRVLLCHLG

Conservation Score

0.669

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0648239

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.563

PhyloCSF Frame 3

0

CNTI Score

-0.371136633