McDonnell Genome Institute

Washington University

Transcript

lnc-TSPAN11-6:1

Chromosome

chr12

Gene Name

lnc-TSPAN11-6

Start

30861920

CPC Label

noncoding

End

30862179

Cancer

CCRC

Strand

+

Peptide

EGMNIVEAMKR

Modified Peptide

n[230]EGMNIVEAMKR

Peptide Length

11

ORF Length

64

Open Reading Frame (ORF)

LSMANAGPITNSSQFFICTAKTQWLHGKDVVFGKVKEGMNIVEAMKRFGSSGKTSKKITIADCG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0980935

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.966

PhyloCSF Frame 3

0

CNTI Score

0.659445956