McDonnell Genome Institute

Washington University

Transcript

lnc-TSPAN11-5:1

Chromosome

chr12

Gene Name

lnc-TSPAN11-5

Start

30200982

CPC Label

noncoding

End

30217916

Cancer

LUAD

Strand

+

Peptide

GGTMVEK

Modified Peptide

n[230]GGTMVEK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MVLPDAQFGRLVRGGTMVEKKHSFLVFPNCGYDHKGDHL

Conservation Score

0.439

PhyloCSF Frame 1

-5.159

No. of Spectra

13

CPC Coding Probability

0.0364386

PhyloCSF Frame 2 

-4.349

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-3.345

CNTI Score

-0.365234323