McDonnell Genome Institute

Washington University

Transcript

lnc-TSN-14:7

Chromosome

chr2

Gene Name

lnc-TSN-14

Start

121902489

CPC Label

coding

End

122252861

Cancer

OSCC

Strand

+

Peptide

TAIMLGTQNMK

Modified Peptide

n[145]TAIM[147]LGTQNM[147]K

Peptide Length

11

ORF Length

45

Open Reading Frame (ORF)

LSAGGADCQACIGRRTAIMLGTQNMKCSSLTFLLTTANTRGVVQV

Conservation Score

0.043

PhyloCSF Frame 1

-4.8

No. of Spectra

3

CPC Coding Probability

0.693932

PhyloCSF Frame 2 

-4.305

CNTI Index

noncoding

Max Probability

0.8282

PhyloCSF Frame 3

-5.33

CNTI Score

-0.351201822