McDonnell Genome Institute

Washington University

Transcript

lnc-TSN-14:3

Chromosome

chr2

Gene Name

lnc-TSN-14

Start

121902489

CPC Label

noncoding

End

121958072

Cancer

OV

Strand

+

Peptide

EDFLDNAVSANLEGIISALDNAR

Modified Peptide

n[145]EDFLDNAVSANLEGIISALDNAR

Peptide Length

23

ORF Length

88

Open Reading Frame (ORF)

MERPHCLMEGLENNFVAFYAQLLGSSPKFTHLQHSLRTLWASMFREDFLDNAVSANLEGIISALDNARIRLTYFTSFSSSPSFSHIAL

Conservation Score

0.212

PhyloCSF Frame 1

-4.69

No. of Spectra

1

CPC Coding Probability

0.0824737

PhyloCSF Frame 2 

-5.187

CNTI Index

noncoding

Max Probability

0.702

PhyloCSF Frame 3

-5.563

CNTI Score

-0.324895133