McDonnell Genome Institute

Washington University

Transcript

lnc-TSN-10:1

Chromosome

chr2

Gene Name

lnc-TSN-10

Start

121506913

CPC Label

noncoding

End

121513172

Cancer

CCRC

Strand

+

Peptide

GSEGSQFR

Modified Peptide

n[230]GSEGSQFR

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LGRGKNMKTSSLLKLQKLAGCGGGFARGSEGSQFRLKQASQTYTTGREVSK

Conservation Score

0.085

PhyloCSF Frame 1

0

No. of Spectra

20

CPC Coding Probability

0.0266021

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.425101272