McDonnell Genome Institute

Washington University

Transcript

lnc-TSHZ2-2:2

Chromosome

chr20

Gene Name

lnc-TSHZ2-2

Start

53608084

CPC Label

noncoding

End

53609314

Cancer

LUAD

Strand

+

Peptide

RSPQPSHSGFSQNPVSR

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

88

Open Reading Frame (ORF)

LRWPKASSPLPAEGLKRSPQPSHSGFSQNPVSRDRLDSNPAAALSRWESRALASPSSQPHLQNGRVPRVKCPHHHEALKRCLAHGDTQ

Conservation Score

0.352

PhyloCSF Frame 1

-4.726

No. of Spectra

5

CPC Coding Probability

0.123534

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7879

PhyloCSF Frame 3

0

CNTI Score

-0.327955871